PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_11766_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 91aa    MW: 10616.2 Da    PI: 9.7852
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_11766_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.63.8e-202067148
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                         +g+WT+eEd ll+++vk++G g+W++++r  g++R +k+c++rw +yl
  cra_locus_11766_iso_1_len_434_ver_3 20 KGPWTAEEDRLLIEYVKLHGEGRWNSVSRLAGLKRNGKSCRLRWVNYL 67
                                         79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.6381571IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.5E-221966IPR009057Homeodomain-like
SMARTSM007175.9E-171969IPR001005SANT/Myb domain
PfamPF002491.6E-182067IPR001005SANT/Myb domain
SuperFamilySSF466893.1E-222191IPR009057Homeodomain-like
CDDcd001676.37E-122267No hitNo description
Gene3DG3DSA:1.10.10.604.8E-66790IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 91 aa     Download sequence    Send to blast
MAAASHEPLG WGMVEEGWRK GPWTAEEDRL LIEYVKLHGE GRWNSVSRLA GLKRNGKSCR  60
LRWVNYLRPD LKRGQITPHE ESIIVELHAR W
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-1320902796MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012481171.12e-52PREDICTED: transcription factor MYB24-like
SwissprotP813912e-34MYB05_ANTMA; Myb-related protein 305
TrEMBLA0A0D2SBE72e-52A0A0D2SBE7_G
STRINGVIT_05s0049g02260.t016e-50(Vitis vinifera)